PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc02794.1.g00010.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 198aa    MW: 21499.8 Da    PI: 9.3935
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc02794.1.g00010.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.11.5e-3091141151
                                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                        SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                                   krien++nrqvtf+kRr g+lKKA+ELSvLCdae+a+++fss+g+lyeys+
  Zpz_sc02794.1.g00010.1.am.mk  91 KRIENTTNRQVTFCKRRSGLLKKAYELSVLCDAEIALVVFSSRGRLYEYSN 141
                                   79***********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PRINTSPR004042.9E-3085105IPR002100Transcription factor, MADS-box
PROSITE patternPS00350085139IPR002100Transcription factor, MADS-box
SMARTSM004327.8E-3586142IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.76E-2886148IPR002100Transcription factor, MADS-box
CDDcd002655.23E-3786143No hitNo description
PROSITE profilePS5006629.99787143IPR002100Transcription factor, MADS-box
PfamPF003194.8E-2692139IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-30105120IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-30120141IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MEAAQSTDLM VPLLVLKIRQ TPNSSRCAWT FLDFYRRDFC VQSAALTSVG LKQKDPLPSP  60
GTGSVAAAAS TAGAAEKAAA AGNKGKKVEI KRIENTTNRQ VTFCKRRSGL LKKAYELSVL  120
CDAEIALVVF SSRGRLYEYS NNSACTHPEL FLCVMRAAAC AWFGLGVRFF SCPICVLSFA  180
SLREVDTERK EGGGRKAD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D2e-1886141358Myocyte-specific enhancer factor 2A
3mu6_C2e-1886141358Myocyte-specific enhancer factor 2A
3mu6_B2e-1886141358Myocyte-specific enhancer factor 2A
3mu6_A2e-1886141358Myocyte-specific enhancer factor 2A
1tqe_S3e-1886140458Myocyte-specific enhancer factor 2B
1tqe_R3e-1886140458Myocyte-specific enhancer factor 2B
1tqe_Q3e-1886140458Myocyte-specific enhancer factor 2B
1tqe_P3e-1886140458Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4306312e-70AJ430631.1 Zea mays partial mRNA for putative MADS-domain transcription factor (m2 gene).
GenBankKJ7283132e-70KJ728313.1 Zea mays clone pUT6593 MADS transcription factor (MADS35) mRNA, partial cds.
GenBankMZEAGAMOU2e-70L81162.2 Zea mays AGAMOUS-like protein (AGAMOUS) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960599.13e-39PREDICTED: MADS-box transcription factor 58
SwissprotQ2V0P11e-35MAD58_ORYSJ; MADS-box transcription factor 58
TrEMBLK3ZAE57e-39K3ZAE5_SETIT; Uncharacterized protein
STRINGSi023516m2e-38(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7045522
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.12e-31MIKC_MADS family protein